SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571028581|ref|YP_008900701.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028581|ref|YP_008900701.1|
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily Ribosomal protein L14 1.44e-53
Family Ribosomal protein L14 0.00000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571028581|ref|YP_008900701.1|
Sequence length 122
Comment 50S ribosomal protein L14 RplN [Thermosynechococcus sp. NK55]
Sequence
MIQQETYLNVADNSGAKKLLCIRVLGGGNRRYGSVGDVIIATVKDATPNMAVKKSDVVRA
VIVRTRKTIRRESGMSIRFDDNAAVLINQDGNPRGTRVFGPVARELRDKNFTKIVSLAPE
VL
Download sequence
Identical sequences V5V708
gi|571028581|ref|YP_008900701.1| WP_024125569.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]