SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571028587|ref|YP_008900707.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028587|ref|YP_008900707.1|
Domain Number 1 Region: 86-165
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.26e-23
Family Translational machinery components 0.0004
Further Details:      
 
Domain Number 2 Region: 15-82
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.72e-19
Family Ribosomal S5 protein, N-terminal domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571028587|ref|YP_008900707.1|
Sequence length 174
Comment 30S ribosomal protein S5 RpsE [Thermosynechococcus sp. NK55]
Sequence
MANRRKNPRKVEKETDWQERVVQIRRVSKVVKGGKKLSFRAIVVVGNERGQVGVGVGKAA
DVIGAVRKGVADGKKHLIDVPITKSNSIPHPTFGEGGAARVMIRPAAPGTGVIAGGSVRT
VLELAGVRNVLAKQLGSSNPLNNARAALEALAALRTFQEVAEEREIPIENLYSK
Download sequence
Identical sequences P59126 V5V6I1
NP_680888.1.97157 WP_011055952.1.87165 197221.tlr0097 gi|571028587|ref|YP_008900707.1| gi|22297641|ref|NP_680888.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]