SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571028641|ref|YP_008900761.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028641|ref|YP_008900761.1|
Domain Number 1 Region: 292-465
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.25e-72
Family Transhydrogenase domain III (dIII) 0.00000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571028641|ref|YP_008900761.1|
Sequence length 466
Comment nicotinamide nucleotide transhydrogenase beta subunit PntB [Thermosynechococcus sp. NK55]
Sequence
MDWLTRIEELSYLGAAALFIFGLKKLGSPATARQGNRLAALGMLIAIVVTLLDRQIMSYT
GVLAAIGLGSVIGAIAAYKVEMTAMPQMVGLLNGLGGAASALVGIGEFCRTVAMGEPLTP
STLITIILGVLIGGVTLTGSLVAFGKLQGLISGTPIIFPMQQVINLGLLVAFLVASGWVG
LHPSQLPMFWGLVAIASILGVLFVLPIGGADMPVVISLLNSLSGLAASAAGFIVGNSMLI
IAGALVGASGLILTQIMCKAMNRSLANVLFGGFGSTTTGNAAVAAHATAKSVRTIDPEES
AMMLGYAKSVVIVPGYGMAVAQAQHSVKELADQLERLGVDVKYAIHPVAGRMPGHMNVLL
AEANVPYPQLKDMEDINPEFENVDVALVIGANDVVNPAARTNPGSPVYGMPILDVDRARH
TIVIKRSLNPGFAGIDNELFYKDKTLMLFGNAKEVLNQLIAEVKHL
Download sequence
Identical sequences V5V766
WP_024125626.1.87165 gi|571028641|ref|YP_008900761.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]