SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571028650|ref|YP_008900770.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028650|ref|YP_008900770.1|
Domain Number 1 Region: 220-373
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.9e-46
Family Pentapeptide repeats 0.0001
Further Details:      
 
Domain Number 2 Region: 97-237
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 6.28e-40
Family Pentapeptide repeats 0.00031
Further Details:      
 
Domain Number 3 Region: 16-124
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.35e-26
Family Pentapeptide repeats 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571028650|ref|YP_008900770.1|
Sequence length 449
Comment pentapeptide repeat protein RfrL [Thermosynechococcus sp. NK55]
Sequence
MNPQELLKRYASGERDFNRASLTNGEFINADLRGIILSRADMEWVNLSGANLSGAVLCGA
EIVNAMLIKAELVDANLAGANLSRSDLSWANLTRANLSRAELSETTLRGTVLQGANLSRV
DLANADLRGLTLDGVNLSGANLQGANLHGTELKQANLTRVDLIQADVSNANLSGTNLSGA
NLRGANLTAANLTGANLSRVDLTEVKLSEANLTKAKLVGAELAKADLSSLELSEVNLGGA
NLSGANLSHTNLSRANLSGANLQGANLSHAKLVGTNLRGANLQGANLQGALLDNADLSQT
DLRSANLSGLVFNGVKLRGANLSGANLREVDLTEANFSRADLVEANLSRARLVGANLSRA
TLSEANLSRATLSGATLSRATFSGSLLGTVDLSGVNLSGADLGDANLSGSNLSRADLTRA
NLTAADMSGANLSEVDLRGTIMPDGRRRA
Download sequence
Identical sequences V5V8T4
gi|571028650|ref|YP_008900770.1| WP_024125635.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]