SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571028732|ref|YP_008900852.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028732|ref|YP_008900852.1|
Domain Number 1 Region: 4-159
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 2.62e-39
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571028732|ref|YP_008900852.1|
Sequence length 161
Comment cytochrome b6-f complex subunit IV PetD [Thermosynechococcus sp. NK55]
Sequence
MAKVLKKPDLTNPALRAKLKKGMGHNYYGEPAWPNDLLYIFPVVIMGTIALVIGLAVMDP
AMVGEPADPFATPLEILPEWYLYPTFQIFRVVPNKLLGVLINASIPLGLMLIPFIESVNK
FQNPFRRPVAMTVFLFGTLVTLWLGIGAAFPLDKSLTLGLF
Download sequence
Identical sequences V5V6Y4
WP_024125716.1.87165 gi|571028732|ref|YP_008900852.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]