SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|571028869|ref|YP_008900989.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028869|ref|YP_008900989.1|
Domain Number 1 Region: 246-514
Classification Level Classification E-value
Superfamily PP2C-like 3.4e-53
Family PP2C-like 0.0000895
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571028869|ref|YP_008900989.1|
Sequence length 623
Comment phosphoprotein phosphatase [Thermosynechococcus sp. NK55]
Sequence
MNPPAPNLICPECGTANSIHQVECHHCQVPLLKRYLWAIGSALDHYSVGELVGDRYLVQG
KHLLLDLLPGEPAPSVDNTAQLYRPYLRLFPKRPHVPELFGALSLPEGELLLLEHAPVSC
IDIADAKVVPGLTHAAPLTTIWDKANLVRRLNWLWQIISLWPALVAENVALTLLNPQLLR
AEGSLVRLLQLQAGNNPTLADLGQFWQTHFNFTDQGENFQQAFTILCQQMQDPREAAPES
VRQTLEVLFQQALDDLGYEYHYDIASRSDQGPSRSRNEDKCLPQTDLADQSRVLALVCDG
VGGHEGGDVASGLAIDILAETLKSLNLLETPPATVEQAIQTAIHATNDAINQRNDTEQRH
ERQRMGTTVVGALIEHAHLYLAHIGDSRAYWINRWGCYQLTLDDDVASRDVRLGMSTYHQ
ALELPYGGSLVQALGMAPSQHLHPTVERFLLDEEGILLLCSDGLSDFNRVETYWRQYLLP
VLQGRVSLTAAAEQLIDLANRLNGHDNVTVVLIHCRVKNTAGVLDLDYSNIVCQGELPEV
TDITMGYVPPPEPSELNLTVSQVLESPQPQLQQVHKLGSQGWLLLLIAVGVATAAFSFLA
VMTSMNRSNTVEKPSSSPLIAPK
Download sequence
Identical sequences V5V7Z7
gi|571028869|ref|YP_008900989.1| WP_024125850.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]