SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340622144|ref|YP_004740596.1| from Capnocytophaga canimorsus Cc5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340622144|ref|YP_004740596.1|
Domain Number 1 Region: 9-224
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.62e-59
Family PP-loop ATPase 0.0000579
Further Details:      
 
Domain Number 2 Region: 343-429
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000000000811
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340622144|ref|YP_004740596.1|
Sequence length 432
Comment tRNA(Ile)-2-lysyl-cytidine synthase [Capnocytophaga canimorsus Cc5]
Sequence
MEKRFSQHIQKFLQDDDVILLAISGGLDSIVLFHLLHKLDFEVVLAHCNFQLRGAESDAD
AKFVQNLAQSKGIRCFVKTFDTHKYAESNGLNTQLAARKLRYDWFEQLRQDQDCQYIVTA
HHADDDLETFLINLSRGTGIKGLLGIPEKNGNIIRPLLVFSRDEILQYANKHQLKWREDS
SNATDNYLRNRIRHHVLPKLKELHPQFLENFKNTQDFMNQSVIFMEEQIVTIKEQIFSFK
DEMIYIDLEKMSSLKNLDFLLHQIFYPYGFSNVSELKKMMKATSGKQLISGTHRLLKDRN
IWILKPRVVNQSSSFLLKKTDKIVEKPLSLVFENVIAYTSNTAQTIFVDADLLEYPLKIR
AWQSGDVFYPIGLNQKKKVSKFFKDEKLSIFEKEDQWLLVSGEKIVWIIGRRADNRFRVT
SKTVNILKITLK
Download sequence
Identical sequences F9YQ70
gi|340622144|ref|YP_004740596.1| WP_013997477.1.55458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]