SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340622330|ref|YP_004740782.1| from Capnocytophaga canimorsus Cc5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340622330|ref|YP_004740782.1|
Domain Number 1 Region: 216-410
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.05e-67
Family B3/B4 domain of PheRS, PheT 0.0000082
Further Details:      
 
Domain Number 2 Region: 42-200
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.37e-43
Family Myf domain 0.0036
Further Details:      
 
Domain Number 3 Region: 481-701
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.13e-33
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00093
Further Details:      
 
Domain Number 4 Region: 710-808
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 3.27e-30
Family Anticodon-binding domain of PheRS 0.001
Further Details:      
 
Domain Number 5 Region: 418-489
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000604
Family Domains B1 and B5 of PheRS-beta, PheT 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340622330|ref|YP_004740782.1|
Sequence length 809
Comment Phenylalanine--tRNA ligase beta chain [Capnocytophaga canimorsus Cc5]
Sequence
MKISYNWVKSFIKTDWSSEQTAALLTDLGLEVEGIETFESVKGGLKGVVVGHVLQCEQHP
NADRLKVTKVDIGEGNVLQIVCGAPNVAQGQKVPVATIGTILYDENGNPFEIKKGKIRGE
ESYGMICAEDELGLGKGHEGILVLDDKYEPGTPCSEVFEVETDEVFEIGLTPNRADAMSH
YGVARDLRAGMLQKGISLQMITPSVTKFHVDNRLVKLDVEVIDKELAPRYAGVTISGVKV
TESPMWLQNRLKAIGVNPKNNVVDATNYVLHQLGQPLHAFDADQICGKKVVVKKAEAGAK
FTTLDGVERTLDAEDLMIYDADKPLCIAGVLGGMHSAVSERTKNIFLESAYFNPVSVRKS
AKRHGLSTDASFRFERGINIADVKYALMHAALLIQKVAGGEISSDIVDLYPKKQEEFQVF
LTFEKVNKLIGQVIPSDDIKGILHSLDIKINSVTERGLGLLVPSYRVDVQREVDVIEEIL
RVYGYNNVEFSNKINASMSHSSKYDDHNVQNVVGAQLIGQGFYEIMTNSLVPEKFISQYE
TDAQAAVKILNPLSNDLSFMRRNLLFSGLESVAYNLNRRHNDLKFFEFGKTYAKSDKDYL
ENKHLMIYLSGNKTDEHWGEAQQKSDFFQLKGVVNAIFERLNLKNVTELPIAPTSVCQEG
LQLVFQDQVIGVIGVVKSKILKDFGIKQEVLFADLNWSELLNQIKEQKIVYKEISKFPGV
RRDLALLVDEDVLFKAIYDLAFATEKSILKNVSLFDVYQGNKLPQGKKSYAVSFSLQDDN
KTLTDKQIDKTMQKIQQQLQEKLGAVLRD
Download sequence
Identical sequences A0A250G7X1 F9YRE5
WP_013997662.1.55458 gi|340622330|ref|YP_004740782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]