SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340622449|ref|YP_004740901.1| from Capnocytophaga canimorsus Cc5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340622449|ref|YP_004740901.1|
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily YjgF-like 3.3e-45
Family YjgF/L-PSP 0.0000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340622449|ref|YP_004740901.1|
Sequence length 126
Comment hypothetical protein Ccan_16780 [Capnocytophaga canimorsus Cc5]
Sequence
MKKQIIFTEKAPAPIGPYNQAVLAGNTLYVSGQIPVDPQTGEVVKGVEKATKQVMENLKA
VLEVAGATFENVVKTTIFLTDMNDFAQVNAIYGEYFDDATAPARETVQVANLPKFVEVEI
SCIAIL
Download sequence
Identical sequences A0A0B7IIJ6 F9YRZ3
WP_013997779.1.42114 WP_013997779.1.48300 WP_013997779.1.55458 WP_013997779.1.64822 gi|340622449|ref|YP_004740901.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]