SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000005464 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000005464
Domain Number 1 Region: 397-660
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-56
Family YWTD domain 0.0000000198
Further Details:      
 
Domain Number 2 Region: 310-389,660-711
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.16e-20
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 3 Region: 22-60
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000124
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 4 Region: 140-180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000038
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 5 Region: 190-227
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.00038
Further Details:      
 
Domain Number 6 Region: 106-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.00061
Further Details:      
 
Domain Number 7 Region: 226-267
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 8 Region: 272-309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000877
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 9 Region: 64-102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000005464   Gene: ENSTRUG00000002369   Transcript: ENSTRUT00000005497
Sequence length 855
Comment pep:novel scaffold:FUGU4:scaffold_207:35321:40815:1 gene:ENSTRUG00000002369 transcript:ENSTRUT00000005497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILRKTIIALLLRCAQNAAVDAAFICSSTQFKCGNGRCITSRWICDGTDDCGDGTDELQET
CASKTCLPSEYNCGAPLNQCIPGGWHCDDKADCGNEADERNCTAKECKDNEFQCANGHCV
SASFVCDKDDDCSDGSDEASCPKPTCSGRSFQCNNSVCVPAQWRCDGDSDCADGSDEWPQ
NCDGRQKKPASRCSRHEFQCADGECIHGSWRCDGGTDCKDRSDEVNCSRSRCPGDQFQCF
DGTCIAGTLQCDGKHDCSDLSDELGCHIARACEGPAMFKCNTGECISMEKVCNKQRDCVD
NSDEPDEECDRNECQTNNGGCSHYCSDLKLGFNCSCPAGYSLKMDKKTCEDIDECAEPDT
CSQVCINLVGSYKCDCMGGYQIDPLTKTCKAQSGVVPMLYFTNKHDVRRMTLDRSEYVRL
IPQLKNVVALDIDMPNKTIFWSDLSLKKIYSSKIDTAGNSSHHTVVIDSGIGAPEGLAVD
WIHGNIYWIDSALQTISVATTDGSRRKTLITENLEKPRAIVVDPINNFMFWTDWGQQAKI
EKCGLNGMDRIALVTDNIVWPNGITLDVSNHRLYWVDSKLHTLSSIDVNGGTRHSVLFSE
EHLSHPISLTVFQNQVFWTDMDHSAVMSANRLTGRDIRTLAVELDQPEDIILYHDLKQPT
GTNWCSQGNGLNGGCEFLCLPAPLINQRSAKFTCACPDDMFLGSGMRECVKSPVAPPDAS
TTEAPLQPNAPTTKAPFATTARTPPQTGPTRQAAATAQGNKLAAVPGEAPSSHPVALYVV
LPMSLSLPAVVTALVVFGAVLVWRHWRLRNTNTIHFDNPVYQKTTEDELHICRNGSDGYI
YPERQMLSTDDIDVA
Download sequence
Identical sequences H2RZ93
ENSTRUP00000005464 ENSTRUP00000005464 31033.ENSTRUP00000005464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]