SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014141 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014141
Domain Number 1 Region: 520-552,632-706
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000628
Family Anti-sigma factor antagonist SpoIIaa 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014141   Gene: ENSTRUG00000005804   Transcript: ENSTRUT00000014206
Sequence length 751
Comment pep:novel scaffold:FUGU4:scaffold_390:64657:75272:1 gene:ENSTRUG00000005804 transcript:ENSTRUT00000014206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMQRVGAKQYLVARALYSEDSFAEEHEKVCRPHKTTLDHVKQYFKCDAKRAKNTALSLLP
IVGWIKIYRIKEWLLNDIVSGVSTGLVAVLQGLAYCLLASLPPWYGLFSAFFPVVIYFFF
GTSRHISVGPFPVLCLMIGSVVTRLVPDEGPPVNITGFEGLTRDEQRVLVASSVTFLTGI
MQLAMGVLQVGFVVMYLSDTLVSGFTTAAAIHILVSQLKFVLGLQVPGISGPLAIIYTLE
IIFAKITSTNVCDVVIALVIMVVVFIVKELNDRFKSKLPVPIPIEVIMTVIACGVSYAFD
FRVKYGIDVVGYIPQGYESPIAPNLHIFKETAVEAFPMAIVGFAVAFSVAKVYSVKHDYT
IDGNQELIAFGISNIFGASFKSFAASTALSRSAVQESTGGKTQIAGVLSALIVMIVTLAI
GFLLDPLPKSVLGAVVIVNLKGMLMQVREIPYLWRRDKPDCVVWLGTCIASILLGLDLGL
AVGLGVELISVILRTQFPRCSVLANIRGTDIYKDRKDYTNIIEPKGVIIFRIPAPIFFAN
IEFFRSKLTEAVGFNPLKVLRKRNKALRMIRKLLKKGDLQWTSKGFLNTSFQPITESEDE
SNMEELDMSIDFKDLPVSIDWNADLPANISVPKLDLHSLILDFAAVSFLDISALKGLKTM
LKELIRIEVDVYIVACDPYILEKLHDCCFFDDEIKPSIFFLTLHDAMVHVLEKHPECEDK
NTQDDTQIITSVTVHYPDLRNRDRNVFSCQC
Download sequence
Identical sequences H2SP04
ENSTRUP00000014141 ENSTRUP00000014141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]