SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014142 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014142
Domain Number 1 Region: 519-551,631-705
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000628
Family Anti-sigma factor antagonist SpoIIaa 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014142   Gene: ENSTRUG00000005804   Transcript: ENSTRUT00000014207
Sequence length 751
Comment pep:novel scaffold:FUGU4:scaffold_390:64660:74718:1 gene:ENSTRUG00000005804 transcript:ENSTRUT00000014207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRVGAKQYLVARALYSEDSFAEEHEKVCRPHKTTLDHVKQYFKCDAKRAKNTALSLLPI
VGWIKIYRIKEWLLNDIVSGVSTGLVAVLQGLAYCLLASLPPWYGLFSAFFPVVIYFFFG
TSRHISVGPFPVLCLMIGSVVTRLVPDEGPPVNITGFEGLTRDEQRVLVASSVTFLTGIM
QLAMGVLQVGFVVMYLSDTLVSGFTTAAAIHILVSQLKFVLGLQVPGISGPLAIIYTLEI
IFAKITSTNVCDVVIALVIMVVVFIVKELNDRFKSKLPVPIPIEVIMTVIACGVSYAFDF
RVKYGIDVVGYIPQGYESPIAPNLHIFKETAVEAFPMAIVGFAVAFSVAKVYSVKHDYTI
DGNQELIAFGISNIFGASFKSFAASTALSRSAVQESTGGKTQIAGVLSALIVMIVTLAIG
FLLDPLPKSVLGAVVIVNLKGMLMQVREIPYLWRRDKPDCVVWLGTCIASILLGLDLGLA
VGLGVELISVILRTQFPRCSVLANIRGTDIYKDRKDYTNIIEPKGVIIFRIPAPIFFANI
EFFRSKLTEAVGFNPLKVLRKRNKALRMIRKLLKKGDLQWTSKGFLNTSFQPITESEDES
NMEELDMSIDFKDLPVSIDWNADLPANISVPKLDLHSLILDFAAVSFLDISALKGLKTML
KELIRIEVDVYIVACDPYILEKLHDCCFFDDEIKPSIFFLTLHDAMVHVLEKHPECEDKN
TQDDTIITSVTVHYPDLRNRDRNTLYPETKF
Download sequence
Identical sequences H2SP05
ENSTRUP00000014142 ENSTRUP00000014142 XP_003978563.1.43653 31033.ENSTRUP00000014142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]