SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014447 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014447
Domain Number 1 Region: 120-154
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000523
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000014447
Domain Number - Region: 101-206
Classification Level Classification E-value
Superfamily HydA/Nqo6-like 0.00235
Family Nickel-iron hydrogenase, small subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014447   Gene: ENSTRUG00000005936   Transcript: ENSTRUT00000014514
Sequence length 239
Comment pep:novel scaffold:FUGU4:scaffold_86:357561:377077:1 gene:ENSTRUG00000005936 transcript:ENSTRUT00000014514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDELVVCHRHECLRVPASPAPELGLSLPARPSPSAFDAFRPEPNSSHPDLTFSKTPAAAD
ISSSLNSNYLNNFFQLQRNEALNNNVYKNVSPYGSLNNIVDGLNSLTDHFSDLSLSSEPR
KPNKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGLTPYQGKKRCFGEYKCPKCKRKWMSG
NSWANMGQECIKCHINVYPHKQRPLEKPDGLDVSDQSKEHPQHLCEKCKVLGYYCRRVQ
Download sequence
Identical sequences H2SPW0
31033.ENSTRUP00000014447 ENSTRUP00000014447 ENSTRUP00000014447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]