SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016657 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016657
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.57e-22
Family Transducin (heterotrimeric G protein), gamma chain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016657   Gene: ENSTRUG00000006779   Transcript: ENSTRUT00000016729
Sequence length 72
Comment pep:known scaffold:FUGU4:scaffold_212:126338:141017:1 gene:ENSTRUG00000006779 transcript:ENSTRUT00000016729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKAHSSNNINHARRTVQQLRIEASIERIKVSKASADLMNYCSEHARNDPLLMGIPASD
NPFKDKKPCTIL
Download sequence
Identical sequences H2SW69
ENSTRUP00000016657 XP_003975756.1.43653 XP_011614865.1.43653 31033.ENSTRUP00000016657 ENSTRUP00000016657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]