SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000017889 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000017889
Domain Number 1 Region: 4-65
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 8.89e-23
Family Transducin (heterotrimeric G protein), gamma chain 0.0000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000017889   Gene: ENSTRUG00000007253   Transcript: ENSTRUT00000017963
Sequence length 71
Comment pep:novel scaffold:FUGU4:scaffold_246:41853:42146:-1 gene:ENSTRUG00000007253 transcript:ENSTRUT00000017963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMSYCEAHAKGDPLLTPLPASENP
FREKKFFCAIL
Download sequence
Identical sequences H2SZQ1
31033.ENSTRUP00000017889 ENSTRUP00000017889 ENSTRUP00000017889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]