SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000028527 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000028527
Domain Number 1 Region: 5-66
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 2.88e-20
Family Transducin (heterotrimeric G protein), gamma chain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000028527   Gene: ENSTRUG00000011297   Transcript: ENSTRUT00000028641
Sequence length 72
Comment pep:known scaffold:FUGU4:scaffold_68:634793:636011:1 gene:ENSTRUG00000011297 transcript:ENSTRUT00000028641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTSKMSGSSNIVVMKKVVQQLRFEASINRVKVSQAAADLQQFCMQNALQDPLLTGVSSST
NPFRPQKVCSFL
Download sequence
Identical sequences H2TV18
ENSTRUP00000028527 ENSTRUP00000028527 31033.ENSTRUP00000028527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]