SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000035266 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000035266
Domain Number 1 Region: 864-1289
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.56e-139
Family Reverse transcriptase 0.0000441
Further Details:      
 
Domain Number 2 Region: 527-677
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.06e-39
Family Retroviral integrase, catalytic domain 0.0038
Further Details:      
 
Domain Number 3 Region: 62-152
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.6e-17
Family SCAN domain 0.0024
Further Details:      
 
Domain Number 4 Region: 189-215
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000471
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000035266   Gene: ENSTRUG00000013799   Transcript: ENSTRUT00000035394
Sequence length 1304
Comment pep:novel scaffold:FUGU4:scaffold_18:2009709:2013862:1 gene:ENSTRUG00000013799 transcript:ENSTRUT00000035394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDLDTFFLLFERLAKARKWSDSEQTLLLQCVLTGKAQEAFSALSMADSENYNSVKIAVLK
AYELVPEAYRQKFRTSRKHDKTYVEFVRELTTLFNRWRIASGVETFPQLCELILLEQFKF
TLPERIATFLAEHKVKSASEAAVLADEYALTHKIRGNWSRRDMPSSTQKMDGLGLELEVD
LPKSGGIHEKQYQGRTCNYCLGQGHWKRECPVLKSNSRFYQGVRPEKPVALAVSVRAAGF
VSLVGSGKRVRVNILRDSGALDSFILESVLPFSSDSDTGSCVKVRGMGPNVLTVPLHKLS
LSSNLVQAGIHVILGNDLARTHVQGGALLIPEGVTRSDTVEPGSGKHTDSAVYPVGVVTR
AQSRSGSETEGKDKLRNCSRFPLFDPLLSVTRSELIQEQEEDSSLQEVFHQVRSEGELEN
TVQGYFLEEGLLLRKWVPQGENFVGEPIFQVVVPIKFRSAVLQTAHNAGAGHLGVRKTYD
KVLRYFYWPRLKRDVSAHIKTCHICQITGKPNQSIKPAPLCPVQADSQPFERLLIDCVGP
LPKSKAGSMYLLTVMCLSTRYPAAYPLRNITTKAVVKALSQFISVFGIPKVIQSDQGTNF
TSHMFAEILKQLHVKHALSSPYHPQSQGAIERFHQTLKSLLRSYCSELDRDWEEGLPWLM
MDAREVTQESTGFSPNDLVFGHAVRGPLAVLHDEWKKTSPPTNLTDYVNGFRRRLYEVVK
LAKANLEKSQRKMKEKRVFSPGDQVLALLPLVGSPFQAKFSGPYAVVRQSSDQNYIIATP
DRRKKSQLCHVNLLKPYYALPSVPRGTLGERPVAVAASVGNSDPVSEWDSMLQGRLRNSE
SLSKLEMLLDHLPETRRNQIIELIHSFPSLFSDTPSRTHLVEHDIDVGDAHPIRQRFYRV
SPKKREQLETEVRYMLEHDIAVPSSSSWASPCLLVVKPDNTFRPCTDFRKVNKITKPDSF
PLPRMEDCVDQVGSAKFVSKFDLLKGYWQVPLSKRAQDVASFITSSGLYSYKVMPFGLRN
APATFQRLMNTVVAGLDGCAVYLDDVVIYSDTWENHLQHIKALFDRLEWANRTINLAKCE
VARATVTYLGKVVGQGHVRPVRAKVLAIDQFSPPTTKKELMRFLGMVGYYRAFCRNFSTV
VAPLTSLLSEKAKFEWSPLCQQAFEEVKLVISSAPVLAAPRMGEPFKLQVDASKLGAGAV
LLQIGEDEIDHPVSFFSRKFNSYQLNYSIVEKEALALIWALQHYEVYVEPLVVYTDHNPL
TFLHSLQNPNQRLMRWCLFLQPYNLDIRHIKGAENVLADALSRA
Download sequence
Identical sequences H2UE97
ENSTRUP00000035266 31033.ENSTRUP00000035266 ENSTRUP00000035266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]