SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000037105 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000037105
Domain Number 1 Region: 3-61
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 3.01e-20
Family Transducin (heterotrimeric G protein), gamma chain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000037105   Gene: ENSTRUG00000014507   Transcript: ENSTRUT00000037237
Sequence length 68
Comment pep:novel scaffold:FUGU4:scaffold_44:1511026:1511803:-1 gene:ENSTRUG00000014507 transcript:ENSTRUT00000037237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSNSNLSNMRRTVEQLKLEASVERIKVSQAAAELQQYCLQNAGKDALLVGVPTGSNPFR
EPRSCTVV
Download sequence
Identical sequences H2UJI4
31033.ENSTRUP00000037105 ENSTRUP00000037105 ENSTRUP00000037105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]