SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000041160 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000041160
Domain Number 1 Region: 3-63
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 2.09e-23
Family Transducin (heterotrimeric G protein), gamma chain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000041160   Gene: ENSTRUG00000016101   Transcript: ENSTRUT00000041304
Sequence length 68
Comment pep:novel scaffold:FUGU4:scaffold_10:2745491:2745772:-1 gene:ENSTRUG00000016101 transcript:ENSTRUT00000041304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTTNNIAQARKLVEQLRIEAGFERIKVSKAAADLMSYCEQHARSDPLLVGVPTSENPFK
DKKPCIIL
Download sequence
Identical sequences H2UW32 Q4RMR9
ENSTNIP00000020322 ENSTRUP00000041160 XP_003962587.1.43653 XP_011617441.1.43653 XP_016303849.1.79318 XP_016365593.1.44103 XP_018974526.1.5815 XP_018974527.1.5815 XP_018974528.1.5815 XP_020774686.1.12261 XP_020774687.1.12261 ENSTRUP00000041160 ENSTNIP00000020322 31033.ENSTRUP00000041160 99883.ENSTNIP00000020322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]