SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043531 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000043531
Domain Number 1 Region: 5-66
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 3.53e-22
Family Transducin (heterotrimeric G protein), gamma chain 0.0000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043531   Gene: ENSTRUG00000017002   Transcript: ENSTRUT00000043676
Sequence length 72
Comment pep:novel scaffold:FUGU4:scaffold_6:2899094:2899389:-1 gene:ENSTRUG00000017002 transcript:ENSTRUT00000043676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGMSNNMAKIADARKTVEQLKLEVNIERMMVSKAAADLMAYCENHAKEDPLVTPVPSSEN
PFREKKLFCTIL
Download sequence
Identical sequences H2V2V0
31033.ENSTRUP00000043531 ENSTRUP00000043531 ENSTRUP00000043531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]