SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000045742 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000045742
Domain Number 1 Region: 297-424
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.01e-41
Family Regulator of G-protein signaling, RGS 0.0000313
Further Details:      
 
Domain Number 2 Region: 2-103
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.07e-26
Family DEP domain 0.012
Further Details:      
 
Domain Number 3 Region: 221-286
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 2.22e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000045742   Gene: ENSTRUG00000017842   Transcript: ENSTRUT00000045896
Sequence length 472
Comment pep:novel scaffold:FUGU4:scaffold_94:305756:318935:1 gene:ENSTRUG00000017842 transcript:ENSTRUT00000045896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIEEIVTLIQDETEGVPIRTVKSFMTKIPSVVTGADIVQWLMKNLSIEDPVEAMHIGSLI
AAQGYFFPISDHVLTLKDDGAFYRFQAPYFWPSHCWEPENTDYAIYLCKRTMQNKTRLDL
ADYEAENLARLQRAFARKWEFIYMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPG
CVNTTEMDIRKCRRMKNPHRVKKSVYSVAEEGPQSQSPVHTPSHQCRKDTKEDVEKEIFF
LNAQLDRHCLKMSKVAESLISYTEQYIEYDPFVTTPELSNPWLSDDPLLWDLEASKEPSQ
QRVKKWGFSLEEALKDPAGQELFLKFLESEFSSENLRFWLAVQDLKRMPQHDVTQRVEDI
WAEFLAEGAPSPINLDSHSYERTSQNLKDPGRYSYEDAQDHIYKLMKSDSYARFLRSNVY
QDLLMARKKPETEQGRRTSLEKFTRSVVIHQCTAFPPHRGGQPELKKTTTTV
Download sequence
Identical sequences H2V952
ENSTRUP00000045742 31033.ENSTRUP00000045742 ENSTRUP00000045742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]