SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336319298|ref|YP_004599266.1| from [Cellvibrio] gilvus ATCC 13127

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336319298|ref|YP_004599266.1|
Domain Number 1 Region: 24-242
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.16e-45
Family Phosphoglucomutase, first 3 domains 0.0014
Further Details:      
 
Domain Number 2 Region: 319-462
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.26e-30
Family Phosphoglucomutase, first 3 domains 0.0032
Further Details:      
 
Domain Number 3 Region: 450-558
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 4.45e-19
Family Phosphoglucomutase, C-terminal domain 0.0046
Further Details:      
 
Domain Number 4 Region: 217-330
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.00000824
Family Phosphoglucomutase, first 3 domains 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336319298|ref|YP_004599266.1|
Sequence length 560
Comment phosphoglucomutase, alpha-D-glucose phosphate-specific [[Cellvibrio] gilvus ATCC 13127]
Sequence
MHQRAGTVALPEDLIDVDALVGAYYDRIPDPTHPDEQVVFGTSGHRGSSLRTAFNEAHIV
AITQAIVEYRRAQGTDGPLFIGRDTHGLSEPAQRTAIEVLVANGVEVHVDARDSFTPTPA
VSLAILRHNGAGTAAGVRTHGPGLADGIVVTPSHNPPADGGFKYNPPHGGPAGGDATGPI
AARANELLAGGWRQVPRTAYDAAIGSDLVKRHDYLTAYVDDLANVIDFDAIRSAGVRIGA
DPLGGAMAEYWGVIGERYGLDLTVVNPTVDPRWPFMTLDWDGKIRMDCSSPYAMASLVAR
MTAGDGPAPYDIATGNDADSDRHGIVTPDGGLLNPNHYLAVMISYLYGGARPGWSPDAAI
GKTLVSSSLVDRVGARLGRRVVEVPVGFKWFVPGLIDGSVGFGGEESAGASFLRTDGTVW
TTDKDGPIACLLASEILATTGRSPSEHHRALVDELGESWYARIDAAATREEKARLGALSP
AQVTATTLAGAPITARLTQAPGNGESIGGLKVTTDDAWFAARPSGTEDVYKIYAESFVSA
EHLAQVQAEAKDVVSAALAG
Download sequence
Identical sequences F8A2Y1
WP_013882228.1.66935 gi|336319298|ref|YP_004599266.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]