SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336319572|ref|YP_004599540.1| from [Cellvibrio] gilvus ATCC 13127

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336319572|ref|YP_004599540.1|
Domain Number 1 Region: 1-379
Classification Level Classification E-value
Superfamily Phase 1 flagellin 3.4e-93
Family Phase 1 flagellin 0.00000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336319572|ref|YP_004599540.1|
Sequence length 379
Comment flagellin domain protein [[Cellvibrio] gilvus ATCC 13127]
Sequence
MGLSINNNIAALNSYRNLSSTQNDLSKSLEKLSSGLRINRAADDAAGLAISEGLRAQIGG
TKQAVRNAQDGISVVQTAEGALTETHSILQRMRTLSVQAGNDGGLSNSAKSNIQDEMDQL
KTELTRIADTTQFNGTKLLNGNYNGTFQVGANTAAADKISVDLTGSSMGAVGLGVDGVNV
TNTGTSWTADVDLAAAVAPSGAVGALSITTAAGVTNLALDLTAWDTTGTSDAAKANHALL
NDELSKAVSSTNFSASVDSYGKVTIGGAGITAASALTVAAASTPGSGSADAAINSIDAAI
TKVSGVRSQLGAVQNRFDHTINNLNVAVENLSASESRVRDTDMAQEMVSFTRSQILSQAG
TAMLAQAKSLPQSVLQLLQ
Download sequence
Identical sequences F8A5F5
WP_013882497.1.66935 gi|336319572|ref|YP_004599540.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]