SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336319577|ref|YP_004599545.1| from [Cellvibrio] gilvus ATCC 13127

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|336319577|ref|YP_004599545.1|
Domain Number - Region: 89-127
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.00327
Family Phase 1 flagellin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336319577|ref|YP_004599545.1|
Sequence length 132
Comment hypothetical protein Celgi_0455 [[Cellvibrio] gilvus ATCC 13127]
Sequence
MSIFGAIGIAQSGLTVHRTWLDAVSDNLANISTVRPTSEAAFQARYVVAQETPGPEGGAQ
VVGAAFGSAEGRMVYEPANPLADENGYVRYPDIDMSSQMTQLIMAQRGYQANAAVVDRAK
ETYTAALQIGRS
Download sequence
Identical sequences F8A5G0
gi|336319577|ref|YP_004599545.1| WP_013882502.1.66935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]