SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336320060|ref|YP_004600028.1| from [Cellvibrio] gilvus ATCC 13127

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336320060|ref|YP_004600028.1|
Domain Number 1 Region: 97-292
Classification Level Classification E-value
Superfamily Formyltransferase 1.02e-59
Family Formyltransferase 0.00029
Further Details:      
 
Domain Number 2 Region: 12-91
Classification Level Classification E-value
Superfamily ACT-like 2.37e-19
Family Glycine cleavage system transcriptional repressor 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336320060|ref|YP_004600028.1|
Sequence length 292
Comment formyltetrahydrofolate deformylase [[Cellvibrio] gilvus ATCC 13127]
Sequence
MSHTVTPASAPAGTHWVLTLSCPDRPGIVHAVAGLLAEHGGNITESQQFGDPLSGLFFMR
VQVTSSATYDELAAALAPVAERFALQWSLDVAGRPVRTLVMGSTAAHCLNDLAFRQRSEA
LPVDLVAVVSNHTSLEPLAQFYGIPFHHVPVTAATKADAEARLLALVEELDVELVVLARY
MQILSDDLCRRLAGRVINIHHSFLPSFKGARPYAQAHDRGVKLIGATAHYVTGDLDEGPI
IEQDVERVDHTRAVEDLVALGQDVERRALARAVRWHAEHRVLLDGHRTIVFR
Download sequence
Identical sequences F8A0B6
gi|336320060|ref|YP_004600028.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]