SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336320285|ref|YP_004600253.1| from [Cellvibrio] gilvus ATCC 13127

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336320285|ref|YP_004600253.1|
Domain Number 1 Region: 1-55
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 2.01e-20
Family Ribosomal protein L32p 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336320285|ref|YP_004600253.1|
Sequence length 65
Comment ribosomal protein L32 [[Cellvibrio] gilvus ATCC 13127]
Sequence
MAVPKRKMSRSNTRARRSQWKTTATTLSTCPNCRADKRPHTACQSCGTYNGRQYAEALRS
EFDAR
Download sequence
Identical sequences F8A1M8
gi|336320285|ref|YP_004600253.1| WP_013883204.1.66935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]