SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336321562|ref|YP_004601530.1| from [Cellvibrio] gilvus ATCC 13127

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336321562|ref|YP_004601530.1|
Domain Number 1 Region: 5-295
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 5.23e-72
Family ATP synthase (F1-ATPase), gamma subunit 0.0000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336321562|ref|YP_004601530.1|
Sequence length 299
Comment ATP synthase F1, gamma subunit [[Cellvibrio] gilvus ATCC 13127]
Sequence
MAGSQRVYKQRIKSTQSLKKMFRAQELIAASRIGRARDRVAMASPYSRAITRAVSAVATH
SNVSHPFLMERTDTQRVAVLLVASDRGMAGAYSASVIRETERLIERLQGQGKQVDLFVSG
RRAVSYYTFRQRELAAQWTGSSDAPTSQVAVEIADELLERFRAPADEGGIAEVHVVYTQF
VNMVTQRPRVIRLLPLEVVEGVAPAGESGPLPLYDFEPSPEVVLDALLPRYVRARIFACL
LQAAASELAARQRAMHTATDNAEDLIRMYTRLANQARQGEITQEISEIVSGADALASAS
Download sequence
Identical sequences F8A218
WP_013884480.1.66935 gi|336321562|ref|YP_004601530.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]