SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20806633|ref|NP_621804.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20806633|ref|NP_621804.1|
Domain Number 1 Region: 4-221
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 1.28e-84
Family Tetrapyrrole methylase 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20806633|ref|NP_621804.1|
Sequence length 275
Comment methyltransferase [Thermoanaerobacter tengcongensis MB4]
Sequence
MEEYGTLYLCPTPIGNLEDITLRVLRVLSEVDLIAAEDTRQTLKLLNHYEIKKSLVSYHE
HNKVTMGPKLIEKLKSGKSIALVTDAGTPSISDPGEELVRLCIQEGIKIVPLPGPTAAIT
ALIASGLDASSFVFEGFLPKKSKERREKLERISREERTTILYESPHRLKETLKELKEYIG
ERKVVVARELTKIHEEFIRGTVEEVLEKLGEEVKGEIVIVIEGAKISPLQKDPKELLDKY
LKLGMDKKEAVKKVAEELKVSKREVYKLVIDEDIN
Download sequence
Identical sequences B7R9B0 Q8RDD6
gi|20806633|ref|NP_621804.1| WP_009610864.1.13259 WP_009610864.1.99938 273068.TTE0104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]