SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20806654|ref|NP_621825.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20806654|ref|NP_621825.1|
Domain Number 1 Region: 9-144
Classification Level Classification E-value
Superfamily HydA/Nqo6-like 1.24e-57
Family Nq06-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20806654|ref|NP_621825.1|
Sequence length 155
Comment NADH:ubiquinone oxidoreductase 20 kD subunit and related Fe-S oxidoreductase [Thermoanaerobacter tengcongensis MB4]
Sequence
MGLKEFIEKSFKKSPWVLHYNASSCNGCDIEILACMTPIYDMERFGMMNVGNPKHADILV
VTGSVNTRNKDVLKNIYDQMPEPKVVVAVGVCAATGGVFRDTYNVLGGVDKVIPVDVYVP
GCPAKPEAIIDGLYKATEILKEKYKKMGKAEEVLK
Download sequence
Identical sequences Q8RDB6
gi|20806654|ref|NP_621825.1| 273068.TTE0125 WP_011024632.1.99938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]