SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20806860|ref|NP_622031.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20806860|ref|NP_622031.1|
Domain Number 1 Region: 543-852
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 4.49e-79
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00064
Further Details:      
 
Domain Number 2 Region: 33-344
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.59e-72
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00048
Further Details:      
 
Domain Number 3 Region: 343-534
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.75e-54
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000432
Further Details:      
 
Domain Number 4 Region: 853-1067
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.09e-46
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0017
Further Details:      
 
Weak hits

Sequence:  gi|20806860|ref|NP_622031.1|
Domain Number - Region: 1126-1163
Classification Level Classification E-value
Superfamily SH3-domain 0.000234
Family SH3-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20806860|ref|NP_622031.1|
Sequence length 1229
Comment 5'-nucleotidase [Thermoanaerobacter tengcongensis MB4]
Sequence
MFSQRSRLFSILVAALLIFSLIFPSVPQIAFAATSKTFDFIEVTDFHGYLQNDGKASDGT
LYKQQIAAVMAKQIKDIKAQNPDRTVILSGGDMFQGTPLSNVLRGKPVIEMMKNIGFDAM
ALGNHEYDWGIESVIDTQNATLKNSTIPVLAANVYDKTTGKPVSYVKPYVVIERDGVKIG
IIGIVDNKEFPTIIMPAFIQNVDFKDPVPIVNDLAQQLRQQGVKIVVVLAHMGAYQDSSG
NVSGNLIDFAKQVKGVDAIFGGHTHTIVTTRVNGIPVGVAANYGKGIIDLKITINEDGTI
TAGDMQYIDLTKIYSTPNIDPKYIDPEVQAIVDKANEDVGPIFNEVIGKAAIDLTRTQSA
KPYGDSLLGNWAAEVTRKAVNADFGFANNGGLRIDIPKGDITVGMMYQLMPFDNTIVTMK
MTGAQIKTILEQAVQDGGKGIQVAGLSFKYDPTRPSMHRVFDMRKSDGTPIDMNKSYLVA
TNNFMGTGGDGFTGFTDPEVKKSFVDTYKLVRDAFIEAVKEQGTITSVIDGRIAPATKEG
TLITVLATSDIHGNIFPWDYNTAKPANRGLAKVSTYVKQVREKYPYVVLVDNGDTIQGTP
LSYYYDKIDTKTEYPLAKVMGAMKYDTWTLGNHEFNYGLEVLNRVIKDMRNEGIHVLSAN
TYKDDGTNYVDAYYIKTFNTPQGPVKVGILGLTTKMIPAWENKENYAGLHFNDLVDEAKK
WVPKLREAGADIVVVTMHSGEEKPTDIIPENQVIAVATNVDGIDAIVAGHTHVNIPQHDY
KNPSGQTVIVTEPGKWGEYVSQIYFDITKNDQGKWVIADKWSTTIKMDDSIQADPEILNL
AQPYHDATLKYIGTKIGVATGDFLGTDQTIKPTAIMDLINKVQKYYAKTDLSIAAPLSSS
AKILKGDITIQDIMGVYVYENYLYGIKMTGKQLKAWLEWSARYYKQVSSPNDPITKDPTL
NIPDYNLDQLYGASYVIDLTQPAGHRIKNLKVNGKLVKDDDVFTVAINNYRFNGGGGFMQ
AAGITNPEIVFDSAKAYGDDGQVRNLMIRYIQEHGTISPVVESDWYISTTPVQEEVEVSQ
GTTQPSQQTEQQTASQPVYNYGIVTASALNVREGAGLRYKVIGVLPAGKVVTLLEEVNGW
YKIDYNGKTGYIYSKYVAATPNPSNVVVLKAVKVTAKSGLNVRVNNSLNARKIGAVPYGT
ELKVVGEYNGWYQVLYNGGFGYVYAKYTK
Download sequence
Identical sequences Q8RCR9
gi|20806860|ref|NP_622031.1| 273068.TTE0343 WP_011024797.1.99938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]