SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20806900|ref|NP_622071.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20806900|ref|NP_622071.1|
Domain Number 1 Region: 25-177,277-365
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.71e-40
Family Bacterial dinuclear zinc exopeptidases 0.0056
Further Details:      
 
Domain Number 2 Region: 151-264
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.000000000000344
Family Bacterial exopeptidase dimerisation domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20806900|ref|NP_622071.1|
Sequence length 367
Comment acetylornithine deacetylase [Thermoanaerobacter tengcongensis MB4]
Sequence
MIEAKELLKALIKKASTDPQRGALIPIISALQSIGLDWKLEMIEEDMYNILLPLSSSPKL
IVEVHYDVVPSVIEGYQTKEGEENGRIYGRGTSDVLGGVAILLEVLKRLGREFPWERAGV
WIAFVADEEKGGKGSRHLASSLPSTIQYALVIEPTQSKLAFSSCGALEYELIIKGVPSHG
SIPERGKNSITWTSRFIIKMEETLSKLNNLYNPDIPIQITPLFISGGSEEYSVPHETRLN
FDIRIPPKVPISDVEKEVNSLLENDKDVEVHCKLVEEWAPSWETDEDTDFGQLLQKLYKE
VYNEEPIFKVMESWTDAHNFWAKGIKPVIWGPGDLALAHTPFEYIDIQELEKGKEFLEKF
FYRLLEF
Download sequence
Identical sequences Q8R5U3 U5CCX5
273068.TTE0388 WP_011024832.1.70758 WP_011024832.1.99938 gi|20806900|ref|NP_622071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]