SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20807087|ref|NP_622258.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20807087|ref|NP_622258.1|
Domain Number 1 Region: 206-508
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 3.91e-128
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.00000153
Further Details:      
 
Domain Number 2 Region: 2-194
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.88e-68
Family Inosicase 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20807087|ref|NP_622258.1|
Sequence length 508
Comment bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Thermoanaerobacter tengcongensis MB4]
Sequence
MSRRALISVSKKDGIVEFAKKLEDLGYEIISTGGTYNLLKESGVKVIKVSEVTGFPEIMG
GRVKTLHPKIHGGILAVRDKKEHLKDLNDHGIVPIDLVAINLYPFKETISREKVALEEAI
ENIDIGGPAMIRAAAKNYKYVTVLVDPVDYEKVIEEIKLYGDTKEETRFYLAAKAFGHTA
FYDSLIYEYFREKTNMEFPKVITFAYEKVQDLRYGENPHQKAAFYKNPVKSYGIAECLQL
HGKELSFNNINDANAAIELVREFSEPVAVAIKHTNPCGVAVGNSIYEAYLKAYEADPVSI
FGGIVAFNGKVDVDTAKELVKIFLEIVIAPDFEEEALEILMSKKNLRVLKLKEGYYREFD
LKKVEGGVLVQQKDEIDLDESSIKVVTKRAPTGKEMKDLKFAWKVVKHVKSNAIVLAKDG
VTVGIGVGQVNRIWPTEQAIKQAGERAKGSVLASDAFFPFPDVVEAAARGGITAIIQPGG
SQNDQLSIEAADRAGIAMIFTGIRHFKH
Download sequence
Identical sequences Q8RC55
273068.TTE0592 WP_011025007.1.99938 gi|20807087|ref|NP_622258.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]