SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20807091|ref|NP_622262.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20807091|ref|NP_622262.1|
Domain Number 1 Region: 2-195,296-385
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.65e-87
Family Bacterial dinuclear zinc exopeptidases 0.0000105
Further Details:      
 
Domain Number 2 Region: 181-294
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.15e-29
Family Bacterial exopeptidase dimerisation domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20807091|ref|NP_622262.1|
Sequence length 389
Comment metal-dependent amidase/aminoacylase/carboxypeptidase [Thermoanaerobacter tengcongensis MB4]
Sequence
MDILKEVEKVEEEIIGIRRKIHMHPELGFEEVKTSELVYNYLKDIGLEVKRLAKTGVVGL
LKGDGERTIAIRADMDALPIQEENEVEYASKIPGKMHACGHDVHTAILLGTAKVLSRIKN
VKGNVKFIFQPAEETTGGALPMIEEGVLEGPRVDAIIGLHVDPDLEVGQIGITYGKAYAS
SDMFDVIIKGRSSHGAEPHKGIDALVIAANVISALQTFASRKTSPFTPIVVTVGTIKGGY
ARNIIADRVEMSGIIRMMEEERREEIVESVEKMCKDIAKAYGGAAEFRRVKGYPLLINDK
GFTTLVKKSASMIVGEENVLEVSPSMGVEDFAYFLQRVPGTFYKLGCGNKEKGIDKPLHS
SRFDVDERCIKVGIAVHVMTVLNYFEGKY
Download sequence
Identical sequences Q8RC51
gi|20807091|ref|NP_622262.1| 273068.TTE0596 WP_011025011.1.99938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]