SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20807298|ref|NP_622469.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20807298|ref|NP_622469.1|
Domain Number 1 Region: 128-399
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.61e-109
Family BC ATP-binding domain-like 0.000000107
Further Details:      
 
Domain Number 2 Region: 666-926
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.01e-95
Family BC ATP-binding domain-like 0.00000803
Further Details:      
 
Domain Number 3 Region: 395-546
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 1.44e-51
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000486
Further Details:      
 
Domain Number 4 Region: 549-668
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.74e-48
Family BC N-terminal domain-like 0.0000129
Further Details:      
 
Domain Number 5 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.46e-48
Family BC N-terminal domain-like 0.00000826
Further Details:      
 
Domain Number 6 Region: 935-1061
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 6.02e-22
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20807298|ref|NP_622469.1|
Sequence length 1072
Comment carbamoyl-phosphate synthase large subunit [Thermoanaerobacter tengcongensis MB4]
Sequence
MPKYKDISKVLVIGSGPIIIGQAAEFDYSGTQACKSLKEEGVQVVLVNNNPATIMTDTDI
ADIVYIENPTVEVVEKIIAKERPDGILATLGGQTGLNLAVKLKEAGILDKYNVKLLGTSV
ESIKTAEDRELFKRKMQEIGEPVAESVTVTNVEDALKFAKNYGYPLIIRPAYTLGGTGGG
IAHNDEELISIVDLGLKKSMVGEVLVEKSLYGWKEIEFEVMRDAADNCITICSMENFDPV
GVHTGDSIVVAPAQTLSDYEYQMLRSASIKIIRALKIEGGCNIQFALDPQSHKYYVIEVN
PRVSRSSALASKATGYPIAKIAAKIAIGLRLDEIKNPVTGKTTAFFEPALDYVVTKIPRW
PFDKFYTTDRRIGTQMKATGEVMAIERSFEASLLKAVRSLEIKAYGLRLDSVRGMGTKEI
LEDISVPNDMRLFYIAEALRRNIDIDYINDVTKIDKWFLNKLSNIVNMEKEIEENELSKE
ILKKAKRMGFSDREIATIKGIKEEDVRTLRKKYGIYPSYKMVDTCAAEFESITQYIYSTY
CEEDEVETHDIPKVIVIGSGPIRIGQGIEFDYCSVKALWALKETGIKSIIINNNPETVST
DFDTGDRLYFEPITLEDVLNIYEKEKPLGVMVMFGGQTAINLTEELVKNEVKILGTSFKS
IDISEDREKFSKLLKELNINQPKGGYALTVEDAKDIALKLGFPLLVRPSYVIGGQSMEKV
NTLQELIDYVKHATEVSPGKPVLIDKYIDGREVEVDAVSDGECVLIPGIMEHIERTGVHS
GDSFSIYPARNLTEREINTIIEYTEKISKALNVKGLINIQFAVKEGTVYVLEVNPRASRT
VPIMSKATGVPMVKLAVEVALGKKLKELGYKGGLWPQTPYTVVKAPVFSMEKLTDVEVSL
SPEMKSTGEIMGIDLSYEGALYKALEGAGLKIPKKGKILLSIAERDFQEAVSLVEKLQSL
GYEIYATYRTGKYFSLMGIHANIMSLDHAIKLLKNGYFDAVVNTPTKGKKPDNAGFKLRR
TAVEYRIPLFTSIDTIKAALNAVSKVNVNGLSVLSMNEYQEIQKDNVKNLVL
Download sequence
Identical sequences Q8RBK0
273068.TTE0816 gi|20807298|ref|NP_622469.1| WP_011025209.1.99938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]