SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20807355|ref|NP_622526.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20807355|ref|NP_622526.1|
Domain Number 1 Region: 466-868
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.22e-157
Family DNA polymerase I 0.000000000822
Further Details:      
 
Domain Number 2 Region: 2-168
Classification Level Classification E-value
Superfamily PIN domain-like 1.28e-56
Family 5' to 3' exonuclease catalytic domain 0.0000199
Further Details:      
 
Domain Number 3 Region: 170-283
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 1.21e-35
Family 5' to 3' exonuclease, C-terminal subdomain 0.00018
Further Details:      
 
Domain Number 4 Region: 312-463
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.45e-29
Family DnaQ-like 3'-5' exonuclease 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20807355|ref|NP_622526.1|
Sequence length 871
Comment DNA polymerase I [Thermoanaerobacter tengcongensis MB4]
Sequence
MAKFLLIDGSSLMYRAYYALPMLTTSEGLHTNALYGFTMMLIKLLEEEKPDYVAIAFDKK
APTFRHKEFKEYKATRQAMPEELSEQVELLKEVIDGFNIKTLELEGYEADDIIGTVSKMA
EEKGMEVVIVTGDRDALQLISPRVKVKISKKGITQMEEFDEKAVLERYEITPQQFVDLKG
LMGDKSDNIPGIPNIGEKTAIKLLKEFGSVENLLENISKLSGKIKETIEANRELAVMSKR
LATINRNIPLEIDFEEYRLKEFNYKKLWDLFNKLEFYSLLDSIKKEGEEVIPTVSIRKWK
KVDIREVPRLLESAKNVAFYPLIYEGDVKKIAFSFDGTTLYSDVERLEDLRKIFEREDAE
FVSHEIKDFLVKLSYKGIECKSKYLDTAIMAYLLNPSESNYDLERVLKRYLKVDILSHEE
VFGKGKDRRRYEEVSEEVMAEYICGRCSHLFELKDKLMAFIEEMDMKKLLLEIEMPLVEV
LKSMEVDGFTLDRNVLKELSEKIDERISEILDKIYKEAGYQFNVNSPKQLGEFLFEKLNL
PVIKKTKTGYSTDSEVLEQLTAYNDIVSEIIEYRQLTKLKSTYIEGFLPLMDENDRVHSN
FKQMVAATGRISSTEPNLQNIPVREEFGRQIRRAFIPRTKDGYIVSADYSQIELRVLAHL
SEDEKLIEAFMNNEDIHLRTASEVFKVPPQNVTPEMRRAAKVVNFGIIYGISDYGLAKDL
KISRKEAKEYIDNYFEKYKGVKEYIEKVIRFAKENGYVTTIMNRRRYIPEINSRNFTQRS
QAERLAMNTPIQGSAADIIKMAMVKVYQEFKRLNLKSRLILQVHDELVVDTYKDELELVK
EILKENMENVIKLKVPLVVEIGVGPNWFLAK
Download sequence
Identical sequences Q8RBE6
273068.TTE0874 WP_011025259.1.99938 gi|20807355|ref|NP_622526.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]