SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20807387|ref|NP_622558.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20807387|ref|NP_622558.1|
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.35e-52
Family Methylglyoxal synthase, MgsA 0.0000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20807387|ref|NP_622558.1|
Sequence length 129
Comment methylglyoxal synthase [Thermoanaerobacter tengcongensis MB4]
Sequence
MNIALIAHDQKKELMVNFAIAYKHIFEKCNLYATGHTGQLIKEATGLDVHCLLPGPLGGD
QQIGALIAENKIDLVIFLRDPLTVQPHEPDILALLRVCDVHSIPVATNIATAEVLLKGME
MGLLDWRQI
Download sequence
Identical sequences A0A0F5PN27 A0A101E636 Q8RBB6 U5CJA2
WP_011025284.1.13259 WP_011025284.1.70758 WP_011025284.1.99938 273068.TTE0906 gi|20807387|ref|NP_622558.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]