SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20807417|ref|NP_622588.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20807417|ref|NP_622588.1|
Domain Number 1 Region: 22-71
Classification Level Classification E-value
Superfamily BAS1536-like 0.000000000562
Family BAS1536-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20807417|ref|NP_622588.1|
Sequence length 79
Comment hypothetical protein TTE0936 [Thermoanaerobacter tengcongensis MB4]
Sequence
MYYHGKIVYTNSCRGVAGMKNNEALEKQISNLRRELDNLVTKDEIDYEKVLDISRKLDAL
IVSYIISKKDDYSAAGNYL
Download sequence
Identical sequences Q8RB86 U5CYH9
gi|20807417|ref|NP_622588.1| 273068.TTE0936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]