SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20807450|ref|NP_622621.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20807450|ref|NP_622621.1|
Domain Number 1 Region: 68-293
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.11e-42
Family RecA protein-like (ATPase-domain) 0.047
Further Details:      
 
Domain Number 2 Region: 24-75
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000344
Family Eukaryotic type KH-domain (KH-domain type I) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20807450|ref|NP_622621.1|
Sequence length 330
Comment phosphate starvation-inducible protein PhoH, ATPase [Thermoanaerobacter tengcongensis MB4]
Sequence
MIKELAINIDNVEETANLFGNFDENIKLIEKGLDVKIVVRGGTIKITGEEKNVDSANKLF
TKLMDMIKRGDVITTQNVLYTMNLIDEGEEEKLKELMSDIVCITARGKQIRCKTYGQLRY
VEAIRKNQIVFGIGPAGTGKTYLAMAMAITALKNKEVGRIILTRPAVEAGEKLGFLPGDL
QEKVDPYLRPLYDALYDILGAEVFQKYMEKSLIEVAPLAYMRGRTLDDSFIILDEAQNTT
PEQMKMFLTRIGFGSKAVITGDVTQIDLPKGKKSGLKEVMEILRGIEGIEFVMLSEQDVI
RHPLVAKIIKAYEEYEKRKEESDLEKERGE
Download sequence
Identical sequences Q8RB54
273068.TTE0970 WP_011025344.1.99938 gi|20807450|ref|NP_622621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]