SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20807551|ref|NP_622722.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20807551|ref|NP_622722.1|
Domain Number 1 Region: 510-756
Classification Level Classification E-value
Superfamily EAL domain-like 3.01e-89
Family EAL domain 0.0023
Further Details:      
 
Domain Number 2 Region: 338-495
Classification Level Classification E-value
Superfamily Nucleotide cyclase 3.77e-53
Family GGDEF domain 0.0000973
Further Details:      
 
Domain Number 3 Region: 210-325
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.5e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 4 Region: 15-142
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.5e-18
Family Heme-binding PAS domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20807551|ref|NP_622722.1|
Sequence length 793
Comment diguanylate cyclase/phosphodiesterase [Thermoanaerobacter tengcongensis MB4]
Sequence
MIEKMPSERKNKSFIEESKKSIAYLQKKEEFLSRIFENEQMLIVVWALDGRVVWFNRYTQ
AVIGIAVEEQTERIDISSIIPRDMISRIKENLDDTEDRGIHYKCENPMVLKDGRQIYIMW
HNSIICDDEGNRYIVSTGIDITDLKNAERRLEEANSNLFALNEELMAQQEELSAMNEKLM
AREEELRQNLIEIKRQQDELKRSEERYRLVVEGASDGLWDWDLITDTAYISERWKDIIGL
DKEVVNNYYETWIKFIHPRDIKIVINNLRNHLEKKTPFYLCEYRIKTKDGRYIWVLSRGK
ALWDEEGRAIRIAGSHTDITERKQMESKLKYMAFYDPLTGLPRREVFMDRLKIAMADAKR
NGKKLAVFFVDLDNFKTINDSLGHHIGDRLLKKVARKLKACLRESDTVSRVGGDEFVILL
PDIINIDDTNKVANRILELFNQPIKFNNYELYVTISIGIAIYPDHGKNERAIVKNADIAM
YKAKRDGKNSFQYFDSITKKEVEIASTIRRDLRFALEKGQFFLHYQPIVDARTGKVVSME
ALLRWQHPKKGLISPIHFIPIAEETRQIISIGEWVLRTACKQMKEWRNMGYYGFSVSVNV
SVHQLQQPDFAKVVFDILNEIELEPRFLELEITETVLIEAMDTVVRNLYRLKEMGVKIII
DDFGTENSSFKYLQKFTVDGLKIDRSFVSEIKVEVNKAIVDAITFLGHRMKLGVTAEGVE
TKEQLDCLVESGCDKVQGYYFSKPLPPDEAIRMVQKESNYFIFSPSTQKCCKKVDGTKKH
SGKDKTLGKSENT
Download sequence
Identical sequences Q8RAV9
WP_011025437.1.99938 273068.TTE1081 gi|20807551|ref|NP_622722.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]