SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20807611|ref|NP_622782.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20807611|ref|NP_622782.1|
Domain Number 1 Region: 92-325
Classification Level Classification E-value
Superfamily Putative modulator of DNA gyrase, PmbA/TldD 0.0000000000288
Family Putative modulator of DNA gyrase, PmbA/TldD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20807611|ref|NP_622782.1|
Sequence length 388
Comment hypothetical protein TTE1154 [Thermoanaerobacter tengcongensis MB4]
Sequence
MCYRIAYFLRSRHFKICKGRIYEIKTYKDSKVHCMMYSGRTVIVESDGGSKMFTLPKAAV
WEPDPGDIYVERGLLDTQGLLAAVETVANYSVDAVLSFYHEERTIETDGFVKYQRMGFYV
LQFQENSRFYIYADYVPEKLKELCIFHMLPHRVVFPNNLPILLSPNVVGHIFHEWVHLLE
LDFLGYETALSIKNLPIFGECVDLQIFEDPKAETIGFNAFNDDARITRRIPIVEQGRIVG
FIDSSAYPYHYLGCGYLGYNNSAFPIPRTTNLVIQARPIVYESERALVITELDLELLNKD
PVSTRIRIKNCEGVYIERGMPIYRVNWKVGIETTVQELVCSMIFLDSSNIHLTVVGGICV
KNGIAVRSAQSAPPVLLEGLLGKSLLPR
Download sequence
Identical sequences Q8RAQ4
WP_011025494.1.99938 gi|20807611|ref|NP_622782.1| 273068.TTE1154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]