SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20807689|ref|NP_622860.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20807689|ref|NP_622860.1|
Domain Number 1 Region: 13-111
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-dependent enzymes 0.0000000000000204
Family D-lysine 5,6-aminomutase alpha subunit, KamD 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20807689|ref|NP_622860.1|
Sequence length 127
Comment hypothetical protein TTE1237 [Thermoanaerobacter tengcongensis MB4]
Sequence
MRREDDFEVRSKHLQHMTDEELDAYFWELAEKIVDPLIELAYYHTSPSIERSVLLRMGFS
SIEAKEIVNRIEERGLLSKGAGHIVLKVAERAKTDYLTAGRGLANGQYLDVLDEIAREAR
ENEAGER
Download sequence
Identical sequences Q8RAI1 U5CRR4
WP_011025563.1.70758 WP_011025563.1.99938 273068.TTE1237 gi|20807689|ref|NP_622860.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]