SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20807711|ref|NP_622882.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20807711|ref|NP_622882.1|
Domain Number 1 Region: 166-552
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.29e-107
Family RecA protein-like (ATPase-domain) 0.0000000101
Further Details:      
 
Domain Number 2 Region: 2-141
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 1.83e-47
Family GSPII protein E N-terminal domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20807711|ref|NP_622882.1|
Sequence length 556
Comment pili biogenesis protein PilB-like ATPase [Thermoanaerobacter tengcongensis MB4]
Sequence
MAKKKLGELLVEVGLITEEQLKHAMEVQSKTGEKLGKVLTKLGYVTENQILEALEFQLGI
PHVDLQKYYIDPEVAKLVPESVAKRHLLIPVKKSEDGLYVAMADPLNIFALDDVRIITKQ
NVKPLIASESSILKAIDRIYGKEQAEKAAQEFKKEFKEEESLPQEVLEEIQNAPAVRFVN
SIIEQAVKSRASDIHIEPTEKDLRIRFRIDGQLTEAMRTIKSTHAPVVTRIKIMANMNIA
ERRLPQDGRFDFTVSGRTVDVRVSSLPTVFGEKIVLRLLDKENFVMTKEQLGFDEEDLPL
FDKLIKRPNGIVLLTGPTGSGKTTTLYAMLRELNKPNVNIITVEDPVEYSLEGINQVQVN
EKAGLTFATALRSILRQDPDIIMIGEIRDTETAEIAIRAAITGHLVLSTLHTNNAAGAIT
RLIDMGIEPYLVASSVVGVIAQRLARKVCDNCKVPYKASKEEKEILGIPEDEEVTLYKGK
GCPVCNRTGYRGRIPIYEIMTVTSDIRELINAKVSSDVIEEKAIKNGMKTLRESARKLIL
QGKTTVEEMVRLTYEE
Download sequence
Identical sequences Q8RAG1
273068.TTE1262 WP_011025581.1.99938 gi|20807711|ref|NP_622882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]