SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20807819|ref|NP_622990.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20807819|ref|NP_622990.1|
Domain Number 1 Region: 317-474
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.61e-32
Family HD domain 0.023
Further Details:      
 
Domain Number 2 Region: 211-306
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.44e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20807819|ref|NP_622990.1|
Sequence length 523
Comment phosphodiesterase [Thermoanaerobacter tengcongensis MB4]
Sequence
MNHLLRRCRSISYVGLIITALIAILIGFLAGFLARKVIAESKIKSAENLARTILESAKKD
AENKKREALLEAKEEIHRLRSDFEKEVRDRRGELQRLEKRLLQKEEILEKRAESLEQKEI
LLEQKQKEIQQLEEQITLLHKKQLEELERISGLTQEEAKSILLESVQKEIQHDMAVMIKE
MENKAKEEADRRAREIVGLAIQRCAADHAAETTVSVVTLPNDEMKGRIIGREGRNIRTIE
TLTGIDLIIDDTPEAVVISGFDPIRREIARIALEKLIEDGRIHPARIEEMVEKAKKEVDN
MIIKAGEEAAFEVGVHGLHPELIKLLGRLKFRTSYGQNVLKHSIEVAHLAGLMAYELGAD
ASIAKRAGLLHDIGKAVDHEVEGPHVMIGAELAKRYHESDAVVHAIMAHHNDVEPQTIEA
VLVQAADAISAARPGARREALEAYIKRLDKLEQIANSFEGVEKAYAIQAGREIRIMVKPE
AISDDELVILARNISKKIEEEVEYPGQIKVTVIRETVAIDYAK
Download sequence
Identical sequences Q8RA57
273068.TTE1372 gi|20807819|ref|NP_622990.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]