SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20807834|ref|NP_623005.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20807834|ref|NP_623005.1|
Domain Number 1 Region: 292-485
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-53
Family Ribonuclease PH domain 1-like 0.0000108
Further Details:      
 
Domain Number 2 Region: 6-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.72e-50
Family Ribonuclease PH domain 1-like 0.0000166
Further Details:      
 
Domain Number 3 Region: 448-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.52e-28
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 144-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.12e-28
Family Ribonuclease PH domain 2-like 0.0017
Further Details:      
 
Domain Number 5 Region: 553-638
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.96e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 6 Region: 616-694
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.58e-21
Family Cold shock DNA-binding domain-like 0.00045
Further Details:      
 
Domain Number 7 Region: 238-319
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 4.18e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20807834|ref|NP_623005.1|
Sequence length 707
Comment polynucleotide phosphorylase [Thermoanaerobacter tengcongensis MB4]
Sequence
MEERTFEMELAGRKLVVQTGKVAQQANGAAWVKYGDTVVLVTACASKEPREGIDFFPLTV
EYEERLYSIGKIPGGFIKREGKPSEKAILSARLIDRPIRPLFPEGYRNDVQVIATVLSVD
PDAQPEIVAMIGSSVALSISDIPFNGPTGSVAVGLVDGKFVINPTYEQREKSLMHLVVSG
TKDAIVMVEAGAKEVPEETILDAIVYAHQYIKQIVEFIEGIVKEVGVPKAEVVLHEIDKE
LEEKVRAYATEKIYNALRTPEKKERNDNLDKVEQEVLEHFKDEYPDNLADIDEVLYKIMK
EQMRKMIKEEKIRVDGRGLDDIRPIWCEVGVLPRTHGSAIFTRGQTQVLTVATLGAIGDI
QILEGIGDEEFKRYMHHYNFPPYSVGEVRPLRGPGRREIGHGALAERALEPVIPSEEEFP
YTIRLVSEVLSSNGSTSQASVCGSTLALMDAGVPIKAPVAGIAMGLIKEEDEVLILTDIQ
GIEDFLGDMDFKVAGTEKGVTAIQMDIKIPGIDRDILQMALEKARKARLYVLQKMLEVIK
EPRKELSKYAPRVVRMVVNPEKIRDIIGPAGKTITKIISETGVKIDIEEDGRLYITAPNL
EAGERAKQMIEAITKDIEVGGIYLGKVLRIAPFGAFVEIAPGKEGLVHISNLSKKRVRRV
EDVVKVGDNILVKVTEIDKLGRIVLSRKDAMPDEEESDNRKSDNRKK
Download sequence
Identical sequences Q8RA43
gi|20807834|ref|NP_623005.1| 273068.TTE1387 WP_011025675.1.99938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]