SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20807908|ref|NP_623079.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20807908|ref|NP_623079.1|
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily Ribosomal protein S16 4.45e-35
Family Ribosomal protein S16 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20807908|ref|NP_623079.1|
Sequence length 82
Comment 30S ribosomal protein S16 [Thermoanaerobacter tengcongensis MB4]
Sequence
MAVRIRLKRFGAKKRPFYRIVVADSRSPRDGRFIDEIGYYNPIAEPAEIKIDVEKAKKWL
SVGAQPSDTVKSLFRKEGIINN
Download sequence
Identical sequences A0A101E7W8 Q8R9X1 U5CRN6
273068.TTE1461 WP_011025728.1.70758 WP_011025728.1.99938 gi|20807908|ref|NP_623079.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]