SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20807916|ref|NP_623087.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20807916|ref|NP_623087.1|
Domain Number 1 Region: 2-161
Classification Level Classification E-value
Superfamily RNase III domain-like 4.53e-52
Family RNase III catalytic domain-like 0.0000386
Further Details:      
 
Domain Number 2 Region: 111-228
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.81e-25
Family Double-stranded RNA-binding domain (dsRBD) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20807916|ref|NP_623087.1|
Sequence length 228
Comment ribonuclease III [Thermoanaerobacter tengcongensis MB4]
Sequence
MLTYLEQKINYEFKDKTLLLEALTHSSWAHEGKNEKVSNERLEFLGDSVLSLVISEYLYK
NRKDLEEGSLSKYRAEIVCEPSLARCARKIELGSFLRMGKGEEISGGRDRDSILADAMEA
LLAAVYLDGGLEAVRRVILDLFKEIIDEVLKGIIYRDYKTRLQEVVQSMEVGKITYELVE
EIGPDHNKTFVTQVKIGDVVLGIGQGKSKKESEQAAAMEALSKLGILK
Download sequence
Identical sequences Q8R9W3
gi|20807916|ref|NP_623087.1| 273068.TTE1469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]