SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20808113|ref|NP_623284.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20808113|ref|NP_623284.1|
Domain Number 1 Region: 5-86
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 2.48e-17
Family Cell division protein ZapA-like 0.004
Further Details:      
 
Weak hits

Sequence:  gi|20808113|ref|NP_623284.1|
Domain Number - Region: 72-118
Classification Level Classification E-value
Superfamily Tropomyosin 0.0262
Family Tropomyosin 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20808113|ref|NP_623284.1|
Sequence length 124
Comment hypothetical protein TTE1687 [Thermoanaerobacter tengcongensis MB4]
Sequence
MELNRVSVTINGNEYILKSDYPEEHVIKLANYVDNVIKELMQSHKNLSQVQLFLLASLNI
ADELFMSKEENNAIKKELLSLKTELEEKNRRIKELEQELENTVNKLLETEEEFRQFLETF
DQEK
Download sequence
Identical sequences Q8R9C8
gi|20808113|ref|NP_623284.1| WP_011025896.1.99938 273068.TTE1687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]