SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20808119|ref|NP_623290.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20808119|ref|NP_623290.1|
Domain Number 1 Region: 92-179
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 1.44e-33
Family Translation initiation factor IF3, C-terminal domain 0.000073
Further Details:      
 
Domain Number 2 Region: 15-88
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 7.32e-29
Family Translation initiation factor IF3, N-terminal domain 0.0000782
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20808119|ref|NP_623290.1|
Sequence length 180
Comment translation initiation factor IF-3 [Thermoanaerobacter tengcongensis MB4]
Sequence
MIIFRRCVFINHRDFQVNEQIRDKEVRLIDQDGKQIGIMSAKEAYKIAQERHLDLVKIVP
NANPPVCKLMDFGKYRYELSKREKEAKKKQKIINVKEIRMSPNIEDHDFGVKLKSAIKFL
KDGDKVKVTIRFRGREAAHTSLAEDLLKRFAEELREYGNVEKAPSMDGRNMMMVIAPKKQ
Download sequence
Identical sequences A0A0F5PLG9 A0A117KW80 Q8R9C2 U5CQZ5
gi|20808119|ref|NP_623290.1| 273068.TTE1693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]