SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20808165|ref|NP_623336.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20808165|ref|NP_623336.1|
Domain Number 1 Region: 2-182,381-463
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.89e-71
Family Bacterial dinuclear zinc exopeptidases 0.00000532
Further Details:      
 
Domain Number 2 Region: 182-378
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 3.06e-48
Family Bacterial exopeptidase dimerisation domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20808165|ref|NP_623336.1|
Sequence length 464
Comment dipeptidase PepV [Thermoanaerobacter tengcongensis MB4]
Sequence
MDLNSYIDSMRDEIIKSVQELVRIKSVQDEPKPGMPYGEGVARALEKALEIAERLGFKTK
NLDGYIGYAEYGEGEEMIAVLGHLDVVPEGDGWTYPPYGAEIHDGKIYGRGTVDDKGPII
AALYGLKAIKDAGLKLSKRVRIIFGTNEETGSHEIKYYLEHDEAPTMGFTPDAQYPIIHA
EKGITMFNVVKDFNKKPSRIVVKYIKGGERPNVVPGYCEARLKVEEENTKKEILNELEAF
VRETGYDLKFEEKEGDLVIKSFGIPAHGSLPHLGKNAIMQLFLFLDRINLDESDVKDFIH
FFATNVGMETNGKTFGIYLKDETGELTFNVGTVSIDEDKGVLGLNIRYPVKHKYEDWMNI
FEEKIKGQGMRIEDMLHQPPLYFPPDHPLIKILSKVYEEQTGQKAELLAIGGGTYAKEMP
NTVAFGPVFPGKPELAHQADEYIEIEDLILNAKIYAHAIYELAK
Download sequence
Identical sequences A0A0F5PNC6 A0A101E3V6 Q8R5R5 U5CTX3
gi|20808165|ref|NP_623336.1| WP_011025942.1.13259 WP_011025942.1.70758 WP_011025942.1.99938 273068.TTE1746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]