SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20808407|ref|NP_623578.1| from Thermoanaerobacter tengcongensis MB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20808407|ref|NP_623578.1|
Domain Number 1 Region: 13-186
Classification Level Classification E-value
Superfamily GlpP-like 2.75e-62
Family GlpP-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20808407|ref|NP_623578.1|
Sequence length 189
Comment glycerol-3-phosphate responsive antiterminator (mRNA-binding) [Thermoanaerobacter tengcongensis MB4]
Sequence
MKDKILETMTEFPIIAAVREIKDVKEAVSSNTQVIFLLSGDIMNICDLVDFIKKNGKIAF
VHFDLIEGLGKDTKAVEYIAERIKPHGIISTRNNILDHAKDFGLFSIQRLFMLDSQALKT
GLSSAKQIRPDAVEILPGIMPSIIKEVANDVLMPVIAGGLVRTKEEVINAIKAGAIAVST
SEKSLWFIE
Download sequence
Identical sequences A0A124FCT2 B7R8Z7 Q8R8J3
273068.TTE2004 WP_009610755.1.13259 WP_009610755.1.99938 gi|20808407|ref|NP_623578.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]